Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL3 Rabbit Polyclonal Antibody (HRP)

KLHL3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PHA2D

UniProt

Q9UH77

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYTAEIEVTEENV

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_059111

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAT1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61879R-BF488 100 µL

GAT1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Enpp2 (NM_057104) Rat Tagged Lenti ORF Clone
RR204039L3 10 µg

Enpp2 (NM_057104) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Listeria welshimeri serovar 6b Peptide chain release factor 1 (prfA)
MBS1075708-01 0.02 mg (E-Coli)

Recombinant Listeria welshimeri serovar 6b Peptide chain release factor 1 (prfA)

Sign In for Pricing
View Details
Recombinant Listeria welshimeri serovar 6b Peptide chain release factor 1 (prfA)
MBS1075708-02 0.02 mg (Yeast)

Recombinant Listeria welshimeri serovar 6b Peptide chain release factor 1 (prfA)

Sign In for Pricing
View Details
Recombinant Listeria welshimeri serovar 6b Peptide chain release factor 1 (prfA)
MBS1075708-03 0.1 mg (E-Coli)

Recombinant Listeria welshimeri serovar 6b Peptide chain release factor 1 (prfA)

Sign In for Pricing
View Details
Recombinant Listeria welshimeri serovar 6b Peptide chain release factor 1 (prfA)
MBS1075708-04 0.1 mg (Yeast)

Recombinant Listeria welshimeri serovar 6b Peptide chain release factor 1 (prfA)

Sign In for Pricing
View Details