Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SETD4 Rabbit Polyclonal Antibody (Biotin)

SETD4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C21orf18, C21orf27

UniProt

A8MTS1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SETD4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VQVKAAFNEETHSYEIRTTSRWRKHEEVFICYGPHDNQRLFLEYGFVSVH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001007262

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Col7a1 siRNA Oligos set (Rat)
16597176 3x 5 nmol

Col7a1 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
NCAM2 Protein, Human, Recombinant (His Tag)
E45H50206M2-100 100 µg

NCAM2 Protein, Human, Recombinant (His Tag)

Sign In for Pricing
View Details
Olfr728 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
33396114 3x 1.0 µg

Olfr728 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Guinea pig Anti-glucoprotein 210 GP210 ELISA Kit
MBS721340-01 48 Well

Guinea pig Anti-glucoprotein 210 GP210 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti-glucoprotein 210 GP210 ELISA Kit
MBS721340-02 96 Well

Guinea pig Anti-glucoprotein 210 GP210 ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti-glucoprotein 210 GP210 ELISA Kit
MBS721340-03 5x 96 Well

Guinea pig Anti-glucoprotein 210 GP210 ELISA Kit

Sign In for Pricing
View Details