Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C21ORF18 Rabbit Polyclonal Antibody (HRP)

C21ORF18 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C21orf18, C21orf27

UniProt

Q9NVD3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C21ORF18

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LTALKLLCLEAEKFTCWKKVLLGEVISDTNEKTSLDIAQKICYYFIEETN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_059134

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDS028 (ITFG2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI 3D8]
TA503045AM 100 µL

MDS028 (ITFG2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI 3D8]

Sign In for Pricing
View Details
Tau (Ab-262) Antibody
8B7239-AAT 50 µg

Tau (Ab-262) Antibody

Sign In for Pricing
View Details
Mouse Rrm2 activation kit by CRISPRa
GA203725 1 Kit

Mouse Rrm2 activation kit by CRISPRa

Sign In for Pricing
View Details
PRELID2 Mouse Monoclonal Antibody [Clone ID: OTI8F1]
CF810806 100 µg

PRELID2 Mouse Monoclonal Antibody [Clone ID: OTI8F1]

Sign In for Pricing
View Details
Diethyl Bromomalonate
TRC-D443840-50G 50 g

Diethyl Bromomalonate

Sign In for Pricing
View Details
NEK5 Rabbit Polyclonal Antibody
TA371235 100 µL

NEK5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details