Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KMT5B Rabbit Polyclonal Antibody (HRP)

KMT5B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CGI85, MRD51, CGI-85, SUV420H1

UniProt

Q4FZB7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SUV420H1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCT4 ORF Vector (Human) (pORF)
ORF012625 1.0 µg DNA

CCT4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Anti-RAB7A Antibody, Rabbit Polyclonal
MBS8100577-01 0.1 mL

Anti-RAB7A Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-RAB7A Antibody, Rabbit Polyclonal
MBS8100577-02 5x 0.1 mL

Anti-RAB7A Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Lentiviral human BEND3 shRNA (UAS) - Lentiviral human BEND3 shRNA (UAS, GFP) plasmid
GTR15292498 1 Vial

Lentiviral human BEND3 shRNA (UAS) - Lentiviral human BEND3 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
MFRP Antibody
MBS8604907-01 0.1 mg

MFRP Antibody

Sign In for Pricing
View Details
MFRP Antibody
MBS8604907-02 0.1 mL (AF405L)

MFRP Antibody

Sign In for Pricing
View Details