Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KMT5B Rabbit Polyclonal Antibody (HRP)

KMT5B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CGI85, MRD51, CGI-85, SUV420H1

UniProt

Q4V775

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SUV420H1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

AAH98121

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK9 Knockout A549 Polyclonal Cells
ARG10569 1 Million

CDK9 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
Carbonic Anhydrase 9 Protein, Human, Recombinant (hFc) V2
TMPY-00689U-01 5 µg

Carbonic Anhydrase 9 Protein, Human, Recombinant (hFc) V2

Sign In for Pricing
View Details
Carbonic Anhydrase 9 Protein, Human, Recombinant (hFc) V2
TMPY-00689U-02 10 µg

Carbonic Anhydrase 9 Protein, Human, Recombinant (hFc) V2

Sign In for Pricing
View Details
Carbonic Anhydrase 9 Protein, Human, Recombinant (hFc) V2
TMPY-00689U-03 20 µg

Carbonic Anhydrase 9 Protein, Human, Recombinant (hFc) V2

Sign In for Pricing
View Details
Carbonic Anhydrase 9 Protein, Human, Recombinant (hFc) V2
TMPY-00689U-04 50 µg

Carbonic Anhydrase 9 Protein, Human, Recombinant (hFc) V2

Sign In for Pricing
View Details
Carbonic Anhydrase 9 Protein, Human, Recombinant (hFc) V2
TMPY-00689U-05 100 µg

Carbonic Anhydrase 9 Protein, Human, Recombinant (hFc) V2

Sign In for Pricing
View Details