Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD5 Rabbit Polyclonal Antibody (FITC)

BTBD5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BTBD5

UniProt

Q9NXS3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BTBD5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GVVVLAGELYALGGYDGQSYLQSVEKYIPKIRKWQPVAPMTTTRSCFAAA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060128

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pax4 (NM_011038) Mouse Tagged ORF Clone Lentiviral Particle
MR221558L4V 200 µL

Pax4 (NM_011038) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral human USF1 sgRNA gene knockout kit - Lentiviral human USF1 sgRNA gene knockout kit (plasmid)
GTR15384821 1 Vial

Lentiviral human USF1 sgRNA gene knockout kit - Lentiviral human USF1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
S100 Rabbit mAb Antibody
orb1951071-01 50 µL

S100 Rabbit mAb Antibody

Sign In for Pricing
View Details
S100 Rabbit mAb Antibody
orb1951071-02 100 µL

S100 Rabbit mAb Antibody

Sign In for Pricing
View Details
Rpa1 (NM_001164223) Mouse Tagged ORF Clone
MR222928 10 µg

Rpa1 (NM_001164223) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
ALDH2 Rabbit Polyclonal Antibody
APRab06763-01 20 µL

ALDH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details