Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD5 Rabbit Polyclonal Antibody (HRP)

BTBD5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BTBD5

UniProt

Q9NXS3

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human BTBD5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GVVVLAGELYALGGYDGQSYLQSVEKYIPKIRKWQPVAPMTTTRSCFAAA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060128

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL54 Antibody
E034313 100 µg -100 µL

MRPL54 Antibody

Sign In for Pricing
View Details
Triticum, wheat, young root t.s., primary xylem and central vessel
As228c 7.6 x 2.6 cm

Triticum, wheat, young root t.s., primary xylem and central vessel

Sign In for Pricing
View Details
STAG1 Polyclonal Conjugated Antibody
orb1626985 100 µL

STAG1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
pEGFP-C3-RIG-I Plasmid
PVTB00424-2b 2 µg

pEGFP-C3-RIG-I Plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal HSF2BP Antibody
NBP1-86325 0.1 mL

Rabbit Polyclonal HSF2BP Antibody

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Immunoglobulin A1 protease (iga), partial
RPC29971-01 20 µg

Recombinant Streptococcus pneumoniae Immunoglobulin A1 protease (iga), partial

Sign In for Pricing
View Details