Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klhl26 Rabbit Polyclonal Antibody (Biotin)

Klhl26 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Klkl26, C630013N10Rik

UniProt

Q8BGY4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Klhl26

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GQLLDVVLTVNSEAFHAHKVVLAACSDYFRAMFTGGMREANQAVIQLQGV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_848886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNG Rabbit Polyclonal Antibody
TA397113 100 µg

IFNG Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ethyl S-(+)-4-Cyano-3-hydroxybutyrate
TRC-E907920-25G 25 g

Ethyl S-(+)-4-Cyano-3-hydroxybutyrate

Sign In for Pricing
View Details
Mouse Bpgm activation kit by CRISPRa
GA200437 1 Kit

Mouse Bpgm activation kit by CRISPRa

Sign In for Pricing
View Details
E-Click EdU Cell Proliferation Flow Cytometry Assay Kit (Red, Elab Fluor® 647)
E-CK-A373-01 50 Assays

E-Click EdU Cell Proliferation Flow Cytometry Assay Kit (Red, Elab Fluor® 647)

Sign In for Pricing
View Details
E-Click EdU Cell Proliferation Flow Cytometry Assay Kit (Red, Elab Fluor® 647)
E-CK-A373-02 200 Assays

E-Click EdU Cell Proliferation Flow Cytometry Assay Kit (Red, Elab Fluor® 647)

Sign In for Pricing
View Details
CD15 / FUT4 / Lewis x (FUT4/815), 0.2mg/mL
BNUB0815-500 1x 500 µL

CD15 / FUT4 / Lewis x (FUT4/815), 0.2mg/mL

Sign In for Pricing
View Details