Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIP120A Rabbit Polyclonal Antibody (Biotin)

TIP120A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TIP120, TIP120A

UniProt

Q86VP6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TIP120A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TVIGELPPASSGSALAANVCKKITGRLTSAIAKQEDVSVQLEALDIMADM

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

136kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_060918

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Murine sTNF RI/TNFRSF1A
P6060-5μg 5 μg

Recombinant Murine sTNF RI/TNFRSF1A

Sign In for Pricing
View Details
CRLF2 Protein Vector (Rat) (pPM-C-HA)
PV261788 500 ng

CRLF2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
GENLISA Hamster 4-HNE (4-Hydroxynonenal) ELISA
KLH1017 1x 96 Well

GENLISA Hamster 4-HNE (4-Hydroxynonenal) ELISA

Sign In for Pricing
View Details
Olfactory Receptor, Family 9, Subfamily A, Member 2 (Olfactory Receptor 9A2, OR9A2, Olfactory Receptor OR7-2) (Biotin)
O6160-23B 100 µL

Olfactory Receptor, Family 9, Subfamily A, Member 2 (Olfactory Receptor 9A2, OR9A2, Olfactory Receptor OR7-2) (Biotin)

Sign In for Pricing
View Details
Human Doublecortin (DCX) ELISA Kit
MBS458799-01 48 Tests

Human Doublecortin (DCX) ELISA Kit

Sign In for Pricing
View Details
Human Doublecortin (DCX) ELISA Kit
MBS458799-02 96 Tests

Human Doublecortin (DCX) ELISA Kit

Sign In for Pricing
View Details