Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wdr45l Rabbit Polyclonal Antibody (HRP)

Wdr45l Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

WIPI-3, Wdr45l, RGD1305141

UniProt

Q2MCP5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YLALVGGGKKPKYPPNKVMIWDDLKKKTVIEIEFSTEVKAVKLRRDRIVV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001034676

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm8298 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3762605 3x 1.0 µg

Gm8298 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Human SLAMF7 (SLAM family member 7) QuickTest ELISA Kit
MBS7618798-01 48 Well

Human SLAMF7 (SLAM family member 7) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human SLAMF7 (SLAM family member 7) QuickTest ELISA Kit
MBS7618798-02 96 Well

Human SLAMF7 (SLAM family member 7) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human SLAMF7 (SLAM family member 7) QuickTest ELISA Kit
MBS7618798-03 5x 96 Well

Human SLAMF7 (SLAM family member 7) QuickTest ELISA Kit

Sign In for Pricing
View Details
Human SLAMF7 (SLAM family member 7) QuickTest ELISA Kit
MBS7618798-04 10x 96 Well

Human SLAMF7 (SLAM family member 7) QuickTest ELISA Kit

Sign In for Pricing
View Details
Recombinant Human FBXO39 Protein - (Dry Ice)
H00162517-P01-25ug 25 µg

Recombinant Human FBXO39 Protein - (Dry Ice)

Sign In for Pricing
View Details