Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL3 Rabbit Polyclonal Antibody (HRP)

METTL3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

M6A, IME4, Spo8, MT-A70, hMETTL3

UniProt

Q86U44

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human METTL3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KIELFGRPHNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_062826

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLCAP (NM_006698) Human Recombinant Protein
TP308259M 100 µg

BLCAP (NM_006698) Human Recombinant Protein

Sign In for Pricing
View Details
Profilin 2 (PFN2) (NM_002628) Human Over-expression Lysate
LY400933 100 µg

Profilin 2 (PFN2) (NM_002628) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse H1f9 activation kit by CRISPRa
GA205695 1 Kit

Mouse H1f9 activation kit by CRISPRa

Sign In for Pricing
View Details
MMP11 Rabbit Monoclonal Antibody
TA422701 100 µL

MMP11 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SENP8 (NM_001166340) Human Over-expression Lysate
LC432692 20 µg

SENP8 (NM_001166340) Human Over-expression Lysate

Sign In for Pricing
View Details
B4galt3 (NM_020579) Mouse Over-expression Lysate
LY706183 100 µg

B4galt3 (NM_020579) Mouse Over-expression Lysate

Sign In for Pricing
View Details