Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL3 Rabbit Polyclonal Antibody (Biotin)

METTL3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

M6A, IME4, Spo8, MT-A70, hMETTL3

UniProt

Q86U44

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human METTL3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KIELFGRPHNVQPNWITLGNQLDGIHLLDPDVVARFKQRYPDGIISKPKN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_062826

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIX homeobox 4 (SIX4) Human shRNA Plasmid Kit (Locus ID 51804)
TL301688 1 Kit

SIX homeobox 4 (SIX4) Human shRNA Plasmid Kit (Locus ID 51804)

Sign In for Pricing
View Details
SLS Lab Pro PURA-Q+20 Type 1 and 2
WAT2199 1 Each

SLS Lab Pro PURA-Q+20 Type 1 and 2

Sign In for Pricing
View Details
DIEXF Rabbit pAb, PerCP-Cy7 conjugated
orb2866881 100 µL

DIEXF Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Anti-CDH3 antibody (6A10) ; IgG1 Chimeric mAb
12-9503-100 100 µg

Anti-CDH3 antibody (6A10) ; IgG1 Chimeric mAb

Sign In for Pricing
View Details
Stk24 (NM_001127494) Rat Tagged ORF Clone
RR207737 10 µg

Stk24 (NM_001127494) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Xpnpep2 3'UTR GFP Stable Cell Line
TU273476 1.0 mL

Xpnpep2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details