Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM11 Rabbit Polyclonal Antibody (FITC)

PRDM11 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PFM8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PRDM11

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGEWLRVWYSEDYMKRLHSMSQETIHRNLARGEKRLQREKSEQVLDNPED

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_064614

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (Melanoma Marker) (TYR/2024R), CF594 conjugate, 0.1mg/mL
BNC942024-500 1x 500 µL

Tyrosinase (Melanoma Marker) (TYR/2024R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UHRF1 (NM_013282) Human Recombinant Protein
TP314251 20 µg

UHRF1 (NM_013282) Human Recombinant Protein

Sign In for Pricing
View Details
IFluor® 810 acid
1385-AAT 1 mg

IFluor® 810 acid

Sign In for Pricing
View Details
Foxf2 Mouse Gene Knockout Kit (CRISPR)
KN306079LP 1 Kit

Foxf2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Uncoated Human SHBG (Sex Hormone Binding Globulin) ELISA Kit
E-UNEL-H0221-01 5x 96 Tests

Uncoated Human SHBG (Sex Hormone Binding Globulin) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human SHBG (Sex Hormone Binding Globulin) ELISA Kit
E-UNEL-H0221-02 15x 96 Tests

Uncoated Human SHBG (Sex Hormone Binding Globulin) ELISA Kit

Sign In for Pricing
View Details