Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM11 Rabbit Polyclonal Antibody (HRP)

PRDM11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PFM8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PRDM11

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGEWLRVWYSEDYMKRLHSMSQETIHRNLARGEKRLQREKSEQVLDNPED

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_064614

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1475), CF740 conjugate, 0.1mg/mL
BNC743433-100 1x 100 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1475), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3497), 0.2mg/mL
BNUB3497-100 1x 100 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3497), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Mouse IL-3 protein (His Tag)
PKSM041460-01 20 µg

Recombinant Mouse IL-3 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-3 protein (His Tag)
PKSM041460-02 100 µg

Recombinant Mouse IL-3 protein (His Tag)

Sign In for Pricing
View Details
MDM2 (SMP14), Biotin conjugate, 0.1mg/mL
BNCB1721-500 1x 500 µL

MDM2 (SMP14), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse GzmB (Granzyme B) ELISA Kit
E-EL-M0594-01 24 Tests

Mouse GzmB (Granzyme B) ELISA Kit

Sign In for Pricing
View Details