Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRDM11 Rabbit Polyclonal Antibody (Biotin)

PRDM11 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PFM8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PRDM11

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PGEWLRVWYSEDYMKRLHSMSQETIHRNLARGEKRLQREKSEQVLDNPED

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_064614

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDH1 Antibody
KC-3956-01 50 μL

IDH1 Antibody

Sign In for Pricing
View Details
IDH1 Antibody
KC-3956-02 100 µL

IDH1 Antibody

Sign In for Pricing
View Details
IDH1 Antibody
KC-3956-03 1 mL

IDH1 Antibody

Sign In for Pricing
View Details
Ornithine Decarboxylase (ODC1) (NM_001287190) Human Tagged ORF Clone
RG238359 10 µg

Ornithine Decarboxylase (ODC1) (NM_001287190) Human Tagged ORF Clone

Sign In for Pricing
View Details
Phosphotyrosine (PY20), CF568 conjugate, 0.1mg/mL
BNC680232-500 1x 500 µL

Phosphotyrosine (PY20), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (rNGFR/1965), CF647 conjugate, 0.1mg/mL
BNC472551-500 1x 500 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (rNGFR/1965), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details