Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBX8 Rabbit Polyclonal Antibody (FITC)

CBX8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PC3, RC1

UniProt

Q9HC52

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CBX8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KRGPKPKTFLLKAQAKAKAKTYEFRSDSARGIRIPYPGRSPQDLASTSRA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065700

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CBF (CEBPZ) activation kit by CRISPRa
GA106893 1 Kit

Human CBF (CEBPZ) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human CSK/C-Src kinase Protein (GST Tag)
PKSH030386 50 µg

Recombinant Human CSK/C-Src kinase Protein (GST Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712880 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS709478 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (F4), CF594 conjugate, 0.1mg/mL
BNC942180-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (F4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GPCR TGR7 (MRGPRD) Human Gene Knockout Kit (CRISPR)
KN424023 1 Kit

GPCR TGR7 (MRGPRD) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details