Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBX8 Rabbit Polyclonal Antibody (Biotin)

CBX8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PC3, RC1

UniProt

Q9HC52

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CBX8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KRGPKPKTFLLKAQAKAKAKTYEFRSDSARGIRIPYPGRSPQDLASTSRA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065700

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome P450 2C18 Antibody (Carrier-free)
orb3168453 100 µg

Cytochrome P450 2C18 Antibody (Carrier-free)

Sign In for Pricing
View Details
ZKSCAN1 Rabbit Polyclonal Antibody (FITC)
orb2115483 100 µL

ZKSCAN1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
C7orf76 Human qPCR Primer Pair (NM_207503)
HP219793 200 Reactions

C7orf76 Human qPCR Primer Pair (NM_207503)

Sign In for Pricing
View Details
Lentiviral mouse Hipk2 shRNA (UAS) - Lentiviral mouse Hipk2 shRNA (UAS, RFP) (100)
GTR15207828 1 Vial

Lentiviral mouse Hipk2 shRNA (UAS) - Lentiviral mouse Hipk2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
MIR16 Polyclonal Antibody, APC-Cy7 Conjugated
bs-12039R-APC-Cy7 100 µL

MIR16 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Rabbit Cerebral Arterial Endothelial Cells
ABC-TC042L 1 Vial

Rabbit Cerebral Arterial Endothelial Cells

Sign In for Pricing
View Details