Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C16ORF44 Rabbit Polyclonal Antibody (HRP)

C16ORF44 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C16orf44

UniProt

Q8N4N3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C16ORF44

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FCCEYLEQEVSEDNYLYLQELASIYSLKRLDAFIDGFILNHFGTLSFTPD

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_079007

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chemokine Like Factor Superfamily 8 (CKLFSF8) Rabbit ELISA Kit
C3859 96 Tests

Chemokine Like Factor Superfamily 8 (CKLFSF8) Rabbit ELISA Kit

Sign In for Pricing
View Details
CD161 (CLEC5B, Killer Cell Lectin-like Receptor Subfamily B Member 1, KLRB1, MGC138614, NKR, NKR-P1, NKRP1A, NKR-P1A) (MaxLight 405)
MBS6252408-01 0.1 mL

CD161 (CLEC5B, Killer Cell Lectin-like Receptor Subfamily B Member 1, KLRB1, MGC138614, NKR, NKR-P1, NKRP1A, NKR-P1A) (MaxLight 405)

Sign In for Pricing
View Details
CD161 (CLEC5B, Killer Cell Lectin-like Receptor Subfamily B Member 1, KLRB1, MGC138614, NKR, NKR-P1, NKRP1A, NKR-P1A) (MaxLight 405)
MBS6252408-02 5x 0.1 mL

CD161 (CLEC5B, Killer Cell Lectin-like Receptor Subfamily B Member 1, KLRB1, MGC138614, NKR, NKR-P1, NKRP1A, NKR-P1A) (MaxLight 405)

Sign In for Pricing
View Details
SH2 domain-containing adapter protein F (SHF) Antibody
abx346770-01 20 µL

SH2 domain-containing adapter protein F (SHF) Antibody

Sign In for Pricing
View Details
SH2 domain-containing adapter protein F (SHF) Antibody
abx346770-02 50 µL

SH2 domain-containing adapter protein F (SHF) Antibody

Sign In for Pricing
View Details
SH2 domain-containing adapter protein F (SHF) Antibody
abx346770-03 100 µL

SH2 domain-containing adapter protein F (SHF) Antibody

Sign In for Pricing
View Details