Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIN3 Rabbit Polyclonal Antibody (HRP)

RIN3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q76LB3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RIN3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEEKSILYLEGSAL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

108kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_079108

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Anti-Thymidylate Synthase antibody (Mouse mAb)
GB155510-100 100 μL

Recombinant Anti-Thymidylate Synthase antibody (Mouse mAb)

Sign In for Pricing
View Details
Lentiviral mouse Rtn3 shRNA (UAS) - Lentiviral mouse Rtn3 shRNA (UAS, iRFP) (100)
GTR15282759 1 Vial

Lentiviral mouse Rtn3 shRNA (UAS) - Lentiviral mouse Rtn3 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Malaria P.f./Pan Rapid Test Cassette [CE]
RAPAMPN402 25 Tests

Malaria P.f./Pan Rapid Test Cassette [CE]

Sign In for Pricing
View Details
Amersham Cy55 Bis NHS ester 50mg
PA15502 1 Each

Amersham Cy55 Bis NHS ester 50mg

Sign In for Pricing
View Details
APC Linked Polyclonal Antibody to Thrombopoietin (TPO)
MBS2128592-01 0.1 mL

APC Linked Polyclonal Antibody to Thrombopoietin (TPO)

Sign In for Pricing
View Details
APC Linked Polyclonal Antibody to Thrombopoietin (TPO)
MBS2128592-02 0.2 mL

APC Linked Polyclonal Antibody to Thrombopoietin (TPO)

Sign In for Pricing
View Details