Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RIN3 Rabbit Polyclonal Antibody (Biotin)

RIN3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q76LB3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RIN3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AGMFLVRRDSSSKQLVLCVHFPSLNESSAEVLEYTIKEEKSILYLEGSAL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

108kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_079108

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Signal Transducing Adaptor Molecule 1 (STAM1)
MBS2028972-01 0.01 mg

Recombinant Signal Transducing Adaptor Molecule 1 (STAM1)

Sign In for Pricing
View Details
Recombinant Signal Transducing Adaptor Molecule 1 (STAM1)
MBS2028972-02 0.05 mg

Recombinant Signal Transducing Adaptor Molecule 1 (STAM1)

Sign In for Pricing
View Details
Recombinant Signal Transducing Adaptor Molecule 1 (STAM1)
MBS2028972-03 0.1 mg

Recombinant Signal Transducing Adaptor Molecule 1 (STAM1)

Sign In for Pricing
View Details
Recombinant Signal Transducing Adaptor Molecule 1 (STAM1)
MBS2028972-04 0.2 mg

Recombinant Signal Transducing Adaptor Molecule 1 (STAM1)

Sign In for Pricing
View Details
Recombinant Signal Transducing Adaptor Molecule 1 (STAM1)
MBS2028972-05 0.5 mg

Recombinant Signal Transducing Adaptor Molecule 1 (STAM1)

Sign In for Pricing
View Details
Recombinant Signal Transducing Adaptor Molecule 1 (STAM1)
MBS2028972-06 1 mg

Recombinant Signal Transducing Adaptor Molecule 1 (STAM1)

Sign In for Pricing
View Details