Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAS1L Rabbit Polyclonal Antibody (FITC)

LAS1L Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

WTS, Las1, Las1-like, dJ475B7.2

UniProt

Q9Y4W2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human LAS1L

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_112483

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASB7 Rabbit Polyclonal Antibody (BF594)
orb2379107 100 µL

ASB7 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
Rabbit Polyclonal Cip4 Antibody [Alexa Fluor 594]
NB100-59833AF594 0.1 mL

Rabbit Polyclonal Cip4 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Serglycin Protein, Human, Recombinant (His & Myc Tag)
E45H51584M9-100 100 µg

Serglycin Protein, Human, Recombinant (His & Myc Tag)

Sign In for Pricing
View Details
TYRP1, ID (TYRP1, CAS2, TYRP, TYRRP, 5,6-dihydroxyindole-2-carboxylic acid oxidase, Catalase B, Glycoprotein 75, Melanoma antigen gp75, Tyrosinase-related protein 1) (MaxLight 405)
MBS6360458-01 0.1 mL

TYRP1, ID (TYRP1, CAS2, TYRP, TYRRP, 5,6-dihydroxyindole-2-carboxylic acid oxidase, Catalase B, Glycoprotein 75, Melanoma antigen gp75, Tyrosinase-related protein 1) (MaxLight 405)

Sign In for Pricing
View Details
TYRP1, ID (TYRP1, CAS2, TYRP, TYRRP, 5,6-dihydroxyindole-2-carboxylic acid oxidase, Catalase B, Glycoprotein 75, Melanoma antigen gp75, Tyrosinase-related protein 1) (MaxLight 405)
MBS6360458-02 5x 0.1 mL

TYRP1, ID (TYRP1, CAS2, TYRP, TYRRP, 5,6-dihydroxyindole-2-carboxylic acid oxidase, Catalase B, Glycoprotein 75, Melanoma antigen gp75, Tyrosinase-related protein 1) (MaxLight 405)

Sign In for Pricing
View Details
POP5-set siRNA/shRNA/RNAi Lentivector (Human)
37232091 4x 500 ng

POP5-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details