Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAS1L Rabbit Polyclonal Antibody (HRP)

LAS1L Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

WTS, Las1, Las1-like, dJ475B7.2

UniProt

Q9Y4W2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human LAS1L

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human

Tested Applications

WB

NCBI Accession Number

NP_112483

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RECQL4 Antibody (C-term)
A03130-1-80ul 80 µL

Anti-RECQL4 Antibody (C-term)

Sign In for Pricing
View Details
MIXL1, ID (MIXL1, MIXL, Homeobox protein MIXL1, Homeodomain protein MIX, MIX1 homeobox-like protein 1, Mix.1 homeobox-like protein) (AP) discontinued
038446-AP 200 µL

MIXL1, ID (MIXL1, MIXL, Homeobox protein MIXL1, Homeodomain protein MIX, MIX1 homeobox-like protein 1, Mix.1 homeobox-like protein) (AP) discontinued

Sign In for Pricing
View Details
TRNAF3 Protein Vector (Human) (pPM-C-His)
PV138789 500 ng

TRNAF3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
SHC3 Rabbit pAb, IRDye 800CW conjugated
orb2825699 100 µL

SHC3 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
SMC5 Rabbit pAb, Pacific Blue conjugated
orb2857988 100 µL

SMC5 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
NLRP4, NT (NLRP4, NALP4, PAN2, PYPAF4, RNH2, NACHT, LRR and PYD domains-containing protein 4, Cancer/testis antigen 58, PAAD and NACHT-containing protein 2, PYRIN and NACHT-containing protein 2, PYRIN-containing APAF1-like protein 4, Ribonuclease inhibito
MBS6325782-01 0.1 mL

NLRP4, NT (NLRP4, NALP4, PAN2, PYPAF4, RNH2, NACHT, LRR and PYD domains-containing protein 4, Cancer/testis antigen 58, PAAD and NACHT-containing protein 2, PYRIN and NACHT-containing protein 2, PYRIN-containing APAF1-like protein 4, Ribonuclease inhibito

Sign In for Pricing
View Details