Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADPGK Rabbit Polyclonal Antibody (HRP)

ADPGK Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ADP-GK, 2610017G09Rik

UniProt

Q9BRR6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ADPGK

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WRRVAVGVNACVDVVLSGVKLLQALGLSPGNGKDHSILHSRNDLEEAFIH

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse

Tested Applications

WB

NCBI Accession Number

NP_112574

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human EAPP sgRNA gene knockout kit - Lentiviral human EAPP sgRNA gene knockout kit (plasmid)
GTR15385961 1 Vial

Lentiviral human EAPP sgRNA gene knockout kit - Lentiviral human EAPP sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Biotinylated Human CD3 epsilon (23-48) Protein, Fc, Avitag™ (MALS verified)
CDE-H82F3-200ug 200 µg

Biotinylated Human CD3 epsilon (23-48) Protein, Fc, Avitag™ (MALS verified)

Sign In for Pricing
View Details
Chicken Ovarian cancer marker/Carbohydrate antigen 125 ELISA kit
GTR10473298 96 Well

Chicken Ovarian cancer marker/Carbohydrate antigen 125 ELISA kit

Sign In for Pricing
View Details
C15orf59 Protein Vector (Human) (pPB-N-His)
PV065742 500 ng

C15orf59 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
PP2D1 Adenovirus (Rat)
37283056 1.0 mL

PP2D1 Adenovirus (Rat)

Sign In for Pricing
View Details
Broad Spectrum Protease Inhibitor Cocktail (EDTA free) (100x), Carrier-free
AR1182-1-carrier-free 1 mL

Broad Spectrum Protease Inhibitor Cocktail (EDTA free) (100x), Carrier-free

Sign In for Pricing
View Details