Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF289 Rabbit Polyclonal Antibody (HRP)

ZNF289 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

IRZ, ZFP289, ZNF289, NBLA10535

UniProt

Q8N6H7

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF289

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YREKIRQLGSAALARHGTDLWIDNMSSAVPNHSPEKKDSDFFTEHTQPPA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

57kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_115765

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal p53DINP1 Antibody
APR00071G 0.1mg

Polyclonal p53DINP1 Antibody

Sign In for Pricing
View Details
(2S,2'S)-1,1'-[[(3-Hydroxytricyclo[3.3.1.13,7]dec-1-yl)imino]bis(1-oxo-2,1-ethanediyl)]bis-2-pyrrolidinecarbonitrile
TRC-H971385-500MG 500 mg

(2S,2'S)-1,1'-[[(3-Hydroxytricyclo[3.3.1.13,7]dec-1-yl)imino]bis(1-oxo-2,1-ethanediyl)]bis-2-pyrrolidinecarbonitrile

Sign In for Pricing
View Details
Human MIR581 qPCR Primer Pair
QH81445S 200 Tests

Human MIR581 qPCR Primer Pair

Sign In for Pricing
View Details
Gastrin Rabbit mAb
E2R50215 100 µL

Gastrin Rabbit mAb

Sign In for Pricing
View Details
Metap2 (NM_019648) Mouse Tagged ORF Clone
MR207657 10 µg

Metap2 (NM_019648) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
OED-set siRNA/shRNA/RNAi Lentivector (Human)
32453091 4x 500 ng

OED-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details