Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTBD6 Rabbit Polyclonal Antibody (HRP)

BTBD6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BDPL

UniProt

Q96KE9

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human BTBD6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YGSSSGKAEYSVKIELKRLGVVLAQNLTKFMSDGSSNTFPVWFEHPVQVE

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DGCR2, ID (DGCR2, IDD, KIAA0163, Integral membrane protein DGCR2/IDD) (MaxLight 405)
MBS6291865-01 0.1 mL

DGCR2, ID (DGCR2, IDD, KIAA0163, Integral membrane protein DGCR2/IDD) (MaxLight 405)

Sign In for Pricing
View Details
DGCR2, ID (DGCR2, IDD, KIAA0163, Integral membrane protein DGCR2/IDD) (MaxLight 405)
MBS6291865-02 5x 0.1 mL

DGCR2, ID (DGCR2, IDD, KIAA0163, Integral membrane protein DGCR2/IDD) (MaxLight 405)

Sign In for Pricing
View Details
E7090 (Standard)
HY-101466R 1 Each

E7090 (Standard)

Sign In for Pricing
View Details
Mycobacterium tuberculosis ESAT6 (6kD early secretory antigen of T cells) discontinued
M9699-58C 1 mg

Mycobacterium tuberculosis ESAT6 (6kD early secretory antigen of T cells) discontinued

Sign In for Pricing
View Details
ANO3 Mouse Monoclonal Antibody
BF8667-01 100 µL

ANO3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ANO3 Mouse Monoclonal Antibody
BF8667-02 200 µL

ANO3 Mouse Monoclonal Antibody

Sign In for Pricing
View Details