Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ttbk2 Rabbit Polyclonal Antibody (FITC)

Ttbk2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TTK, Ttbk, Ttbk1, AI326283, mKIAA0847, 2610507N02Rik, B930008N24Rik

UniProt

Q3UVR3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KPDYQLLTSVFDNSIKTFGVIESDPFDWEKSGTDGSLTTTTTSATPQLHT

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

137kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001020027

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APRT, NT (Adenine Phosphoribosyltransferase) (FITC) discontinued
A2300-15-FITC 200 µL

APRT, NT (Adenine Phosphoribosyltransferase) (FITC) discontinued

Sign In for Pricing
View Details
Art3 (NM_001012034) Rat Tagged ORF Clone
RR208006 10 µg

Art3 (NM_001012034) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Pseudomonas putida DNA mismatch repair protein mutL (mutL), partial
MBS1119043 Inquire

Recombinant Pseudomonas putida DNA mismatch repair protein mutL (mutL), partial

Sign In for Pricing
View Details
Lymphotactin (Small Inducible Cytokine Subfamily C Member 1, SCYC1, Chemokine C Motif Ligand 1, Ltn) (FITC) discontinued
L8010-10A-FITC 100 µL

Lymphotactin (Small Inducible Cytokine Subfamily C Member 1, SCYC1, Chemokine C Motif Ligand 1, Ltn) (FITC) discontinued

Sign In for Pricing
View Details
MADCAM1 Mouse Monoclonal Antibody [Clone:1E1]
E45M14082 100 µg

MADCAM1 Mouse Monoclonal Antibody [Clone:1E1]

Sign In for Pricing
View Details
GPR171, CT (GPR171, H963, Probable G-protein coupled receptor 171, G-protein coupled receptor H963) (MaxLight 750) discontinued
036233-ML750 100 µL

GPR171, CT (GPR171, H963, Probable G-protein coupled receptor 171, G-protein coupled receptor H963) (MaxLight 750) discontinued

Sign In for Pricing
View Details