Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCOR2 Rabbit Polyclonal Antibody (HRP)

RCOR2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8IZ40

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RCOR2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YYYSWKKTRSRTSVMDRQARRLGGRKDKEDSDELEEGRGGVSEGEPDPAD

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_775858

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 (Macrophage Marker) Antibody
orb1712523 0.5 mL

CD68 (Macrophage Marker) Antibody

Sign In for Pricing
View Details
RBM38 Protein Vector (Mouse) (pPM-C-HA)
PV222908 500 ng

RBM38 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
ITGB3, Phosphorylated (Y785) (Integrin beta-3, GT, CD61, GP3A, BDPLT2, GPIIIa, BDPLT16) (FITC)
MBS6423276-01 0.1 mL

ITGB3, Phosphorylated (Y785) (Integrin beta-3, GT, CD61, GP3A, BDPLT2, GPIIIa, BDPLT16) (FITC)

Sign In for Pricing
View Details
ITGB3, Phosphorylated (Y785) (Integrin beta-3, GT, CD61, GP3A, BDPLT2, GPIIIa, BDPLT16) (FITC)
MBS6423276-02 5x 0.1 mL

ITGB3, Phosphorylated (Y785) (Integrin beta-3, GT, CD61, GP3A, BDPLT2, GPIIIa, BDPLT16) (FITC)

Sign In for Pricing
View Details
Mouse Hpd Pre-designed siRNA Set B
SI106336B 1 Each

Mouse Hpd Pre-designed siRNA Set B

Sign In for Pricing
View Details
Olfr631 3'UTR Luciferase Stable Cell Line
TU115376 1.0 mL

Olfr631 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details