Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCOR2 Rabbit Polyclonal Antibody (HRP)

RCOR2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8IZ40

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RCOR2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YYYSWKKTRSRTSVMDRQARRLGGRKDKEDSDELEEGRGGVSEGEPDPAD

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_775858

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZHX3 Protein Vector (Rat) (pPB-N-His)
PV318243 500 ng

ZHX3 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Porcine Soluble Endoglin (sENG) ELISA Kit
MBS267240-01 48 Well

Porcine Soluble Endoglin (sENG) ELISA Kit

Sign In for Pricing
View Details
Porcine Soluble Endoglin (sENG) ELISA Kit
MBS267240-02 96 Well

Porcine Soluble Endoglin (sENG) ELISA Kit

Sign In for Pricing
View Details
Porcine Soluble Endoglin (sENG) ELISA Kit
MBS267240-03 5x 96 Well

Porcine Soluble Endoglin (sENG) ELISA Kit

Sign In for Pricing
View Details
Porcine Soluble Endoglin (sENG) ELISA Kit
MBS267240-04 10x 96 Well

Porcine Soluble Endoglin (sENG) ELISA Kit

Sign In for Pricing
View Details
TAS1R3 (NM_152228) Human Over-expression Lysate
LS083756-100ug 100 µg

TAS1R3 (NM_152228) Human Over-expression Lysate

Sign In for Pricing
View Details