Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rcor2 Rabbit Polyclonal Antibody (HRP)

Rcor2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

1A1, CoR, 1A13, Rcor, Rcor1, CoREST, AW122124

UniProt

Q8C796

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPEANTKFNSRWTTDEQLLAVQAIRRYGKDFGAIAEVIGNKTLTQVKTFF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_473389

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromobenzyl chloride
sc-274410 1 g

2-Bromobenzyl chloride

Sign In for Pricing
View Details
Olfr1309 (NM_146447) Mouse Tagged ORF Clone Lentiviral Particle
MR212786L3V 200 µL

Olfr1309 (NM_146447) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Vom2r62 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
50142156 3x 1.0 µg DNA

Vom2r62 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
AMY2B Mouse Monoclonal Antibody [Clone:4B5]
E45M12931 100 µg

AMY2B Mouse Monoclonal Antibody [Clone:4B5]

Sign In for Pricing
View Details
GTPBP3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
22820156 3x 1.0 µg DNA

GTPBP3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Rabbit Polyclonal RYBP/DEDAF Antibody [Alexa Fluor 488]
NBP1-76842AF488 0.1 mL

Rabbit Polyclonal RYBP/DEDAF Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details