Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL14 Rabbit Polyclonal Antibody (FITC)

KLHL14 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q8WU41

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL14

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAV

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065856

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANXA10 Rabbit Monoclonal Antibody [Clone ID: 23GB3215]
TA424509S 20 µL

ANXA10 Rabbit Monoclonal Antibody [Clone ID: 23GB3215]

Sign In for Pricing
View Details
Cytochrome P450 26B (CYP26B1) (NM_019885) Human Over-expression Lysate
LC402746 20 µg

Cytochrome P450 26B (CYP26B1) (NM_019885) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR560572 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Bempedoic Acid-d5
TRC-B119701-50MG 50 mg

Bempedoic Acid-d5

Sign In for Pricing
View Details
Rbp4 Mouse Gene Knockout Kit (CRISPR)
KN514594 1 Kit

Rbp4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PE Anti-Human CD2 Antibody[RPA-2.10]
E-AB-F1375D-01 20 Tests

PE Anti-Human CD2 Antibody[RPA-2.10]

Sign In for Pricing
View Details