Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL14 Rabbit Polyclonal Antibody (HRP)

KLHL14 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8WU41

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL14

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAV

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065856

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRAMD2 Rabbit Polyclonal Antibody (BF488)
orb2382333 100 µL

GRAMD2 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
SBK2 Antibody, Biotin conjugated
A34160-50UL 50 μL

SBK2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SARP1 Polyclonal Antibody, HRP Conjugated
bs-9478R-HRP 100 µL

SARP1 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
WAC, ID (WAC, KIAA1844, WW domain-containing adapter protein with coiled-coil) (Biotin) discontinued
043800-Biotin 200 µL

WAC, ID (WAC, KIAA1844, WW domain-containing adapter protein with coiled-coil) (Biotin) discontinued

Sign In for Pricing
View Details
HMHA1 Adenovirus (Mouse)
23678054 1.0 mL

HMHA1 Adenovirus (Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal PSMA/FOLH1/NAALADase I Antibody (GCP-04) [DyLight 755]
NBP1-45057IR 0.1 mL

Mouse Monoclonal PSMA/FOLH1/NAALADase I Antibody (GCP-04) [DyLight 755]

Sign In for Pricing
View Details