Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL14 Rabbit Polyclonal Antibody (HRP)

KLHL14 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8WU41

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL14

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAV

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065856

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENDOG (B-2) Alexa Fluor® 488
sc-365359 AF488 200 µg/mL

ENDOG (B-2) Alexa Fluor® 488

Sign In for Pricing
View Details
PTRH2 Rabbit pAb, AE conjugated
orb2875632 100 µL

PTRH2 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
ARL10 CRISPR All-in-one AAV vector set (with saCas9)(Human)
12366151 3x 1.0 µg DNA

ARL10 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
BCOR ORF Vector (Human) (pORF)
ORF000990 1.0 µg DNA

BCOR ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Phospho-MDM2 (Ser166) Recombinant Antibody, Cy7 Conjugated
bsm-62661R-Cy7 100 µL

Phospho-MDM2 (Ser166) Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Anti-IL-13RA1 Antibody (4O210)
TMAY-01356-01 20 µL

Anti-IL-13RA1 Antibody (4O210)

Sign In for Pricing
View Details