Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLHL14 Rabbit Polyclonal Antibody (Biotin)

KLHL14 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q8WU41

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL14

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAV

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065856

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STX11 Human qPCR Template Standard (NM_003764)
HK207126 1 Kit

STX11 Human qPCR Template Standard (NM_003764)

Sign In for Pricing
View Details
Kylt® Staph aureus
31009 100 Reactions

Kylt® Staph aureus

Sign In for Pricing
View Details
Lentiviral human COG7 shRNA (UAS) - Lentiviral human COG7 shRNA (UAS, GFP) (25)
GTR15349415 1 Vial

Lentiviral human COG7 shRNA (UAS) - Lentiviral human COG7 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Pigeon B Cell Differentiation Factor ELISA Kit
MBS090652 Inquire

Pigeon B Cell Differentiation Factor ELISA Kit

Sign In for Pricing
View Details
WHSC1L1P siRNA Oligos set (Human)
69055171 3x 5 nmol

WHSC1L1P siRNA Oligos set (Human)

Sign In for Pricing
View Details
Human N-Sulfoglucosamine Sulfohydrolase ELISA Kit (SGSH)
RK02280 96 Tests

Human N-Sulfoglucosamine Sulfohydrolase ELISA Kit (SGSH)

Sign In for Pricing
View Details