Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEIS2 Rabbit Polyclonal Antibody (FITC)

MEIS2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MRG1, CPCMR, HsT18361

UniProt

O14770

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MEIS2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHS

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_733776

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Ovary
CB506483 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
Tube holder, 11 x 1.5/2.0, 2/pk (1 pack included)
R2020-1520 1 Each

Tube holder, 11 x 1.5/2.0, 2/pk (1 pack included)

Sign In for Pricing
View Details
Bpifb6 Mouse Gene Knockout Kit (CRISPR)
KN502240 1 Kit

Bpifb6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD11b / MAC-1 (Microglial Marker) (ITGAM/3340), CF740 conjugate, 0.1mg/mL
BNC743340-100 1x 100 µL

CD11b / MAC-1 (Microglial Marker) (ITGAM/3340), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (KP1), CF405M conjugate, 0.1mg/mL
BNC050512-100 1x 100 µL

CD68 (KP1), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ubiquitin D (UBD) (NM_006398) Human Recombinant Protein
TP304431 20 µg

Ubiquitin D (UBD) (NM_006398) Human Recombinant Protein

Sign In for Pricing
View Details