Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEIS2 Rabbit Polyclonal Antibody (HRP)

MEIS2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MRG1, CPCMR, HsT18361

UniProt

O14770

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MEIS2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELA

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_733775

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal NAP1 Antibody [Janelia Fluor 646]
NBP1-26592JF646 0.1 mL

Rabbit Polyclonal NAP1 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
HHV4/CMV Rabbit Polyclonal Antibody
orb499836-01 50 μL

HHV4/CMV Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HHV4/CMV Rabbit Polyclonal Antibody
orb499836-02 100 µL

HHV4/CMV Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
HHV4/CMV Rabbit Polyclonal Antibody
orb499836-03 200 µL

HHV4/CMV Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CD20 (HI20a) Monoclonal Antibody
bsm-30098M 100 µL

Human CD20 (HI20a) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human PAK1 Protein, N-His
orb2835434-01 20 µg

Recombinant Human PAK1 Protein, N-His

Sign In for Pricing
View Details