Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF6 Rabbit Polyclonal Antibody (FITC)

TAF6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ALYUS, TAF2E, TAFII70, TAFII80, TAFII85, MGC:8964, TAFII-70, TAFII-80, TAF (II) 70, TAF (II) 80

UniProt

A4D2B3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TAF6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHA

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_620834

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc22a17 Mouse Gene Knockout Kit (CRISPR)
KN315927RB 1 Kit

Slc22a17 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(1E,5E)-1-Iodopentadeca-1,5-diene
TRC-I717455-25MG 25 mg

(1E,5E)-1-Iodopentadeca-1,5-diene

Sign In for Pricing
View Details
2-[N-(D,L-Phenylglycine-d5)]crotonic Acid Ethyl Ester Potassium Salt
TRC-P327147-10MG 10 mg

2-[N-(D,L-Phenylglycine-d5)]crotonic Acid Ethyl Ester Potassium Salt

Sign In for Pricing
View Details
Mouse Cyp26a1 activation kit by CRISPRa
GA200975 1 Kit

Mouse Cyp26a1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human GJA8 activation kit by CRISPRa
GA101807 1 Kit

Human GJA8 activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]
E-AB-F0990L-01 50 Tests

Elab Fluor® 488 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]

Sign In for Pricing
View Details