Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF6 Rabbit Polyclonal Antibody (HRP)

TAF6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ALYUS, TAF2E, TAFII70, TAFII80, TAFII85, MGC:8964, TAFII-70, TAFII-80, TAF (II) 70, TAF (II) 80

UniProt

A4D2B3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TAF6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHA

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_620834

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

iFluor™ 647 Conjugated BrdU Recombinant Rabbit Monoclonal Antibody [PSH0-18]
HA720188F 100 µL

iFluor™ 647 Conjugated BrdU Recombinant Rabbit Monoclonal Antibody [PSH0-18]

Sign In for Pricing
View Details
Mesothelin (MSLN) Mouse Monoclonal Antibody [Clone ID: OTI1G8]
CF805169 100 µg

Mesothelin (MSLN) Mouse Monoclonal Antibody [Clone ID: OTI1G8]

Sign In for Pricing
View Details
RASH/RASK Antibody
8C0313-AAT 50 µg

RASH/RASK Antibody

Sign In for Pricing
View Details
HDAC8 Rabbit Polyclonal Antibody
TA364478 100 µL

HDAC8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Podophyllotoxin 4-O-Glucoside
TRC-P681010-1MG 1 mg

Podophyllotoxin 4-O-Glucoside

Sign In for Pricing
View Details
AKR1C3 Human Gene Knockout Kit (CRISPR)
KN200210LP 1 Kit

AKR1C3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details