Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBX3 Rabbit Polyclonal Antibody (HRP)

CBX3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HECH, HP1-GAMMA, HP1Hs-gamma

UniProt

Q13185

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CBX3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDA

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_009207

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Secretogranin II ELISA Kit
MBS7277574-01 48 Well

Canine Secretogranin II ELISA Kit

Sign In for Pricing
View Details
Canine Secretogranin II ELISA Kit
MBS7277574-02 96 Well

Canine Secretogranin II ELISA Kit

Sign In for Pricing
View Details
Canine Secretogranin II ELISA Kit
MBS7277574-03 5x 96 Well

Canine Secretogranin II ELISA Kit

Sign In for Pricing
View Details
Canine Secretogranin II ELISA Kit
MBS7277574-04 10x 96 Well

Canine Secretogranin II ELISA Kit

Sign In for Pricing
View Details
FSCB Rabbit pAb, PerCP-Cy7 conjugated
orb2872669 100 µL

FSCB Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Human TBX6 Pre-designed siRNA Set B
SI016353B 1 Each

Human TBX6 Pre-designed siRNA Set B

Sign In for Pricing
View Details