Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KEAP1 Rabbit Polyclonal Antibody (FITC)

KEAP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

INrf2, KLHL19

UniProt

Q14145

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KEAP1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWS

Field of Research

Cancer Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_987096

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C-C motif chemokine 5, CCL5/D17S136E/SCYA5 ELISA Kit
MBS1605943-01 48 Well

Human C-C motif chemokine 5, CCL5/D17S136E/SCYA5 ELISA Kit

Sign In for Pricing
View Details
Human C-C motif chemokine 5, CCL5/D17S136E/SCYA5 ELISA Kit
MBS1605943-02 96 Well

Human C-C motif chemokine 5, CCL5/D17S136E/SCYA5 ELISA Kit

Sign In for Pricing
View Details
Human C-C motif chemokine 5, CCL5/D17S136E/SCYA5 ELISA Kit
MBS1605943-03 5x 96 Well

Human C-C motif chemokine 5, CCL5/D17S136E/SCYA5 ELISA Kit

Sign In for Pricing
View Details
Human C-C motif chemokine 5, CCL5/D17S136E/SCYA5 ELISA Kit
MBS1605943-04 10x 96 Well

Human C-C motif chemokine 5, CCL5/D17S136E/SCYA5 ELISA Kit

Sign In for Pricing
View Details
Mouse 6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 2, PFKFB2 ELISA Kit
MBS9305227-01 48 Well

Mouse 6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 2, PFKFB2 ELISA Kit

Sign In for Pricing
View Details
Mouse 6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 2, PFKFB2 ELISA Kit
MBS9305227-02 96 Well

Mouse 6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase 2, PFKFB2 ELISA Kit

Sign In for Pricing
View Details