Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GREB1 Rabbit Polyclonal Antibody (HRP)

GREB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q4ZG55

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GREB1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGNSYAGQLKTTRFEEVLHNSIEASLRSNNLVPRPIFSQLYLEAEQQLAA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_683701

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS4X Peptide - C-terminal region
MBS3247386-01 0.1 mg

RPS4X Peptide - C-terminal region

Sign In for Pricing
View Details
RPS4X Peptide - C-terminal region
MBS3247386-02 5x 0.1 mg

RPS4X Peptide - C-terminal region

Sign In for Pricing
View Details
ZNF43, NT (ZNF43, KOX27, ZNF39, ZNF39L1, Zinc finger protein 43, Zinc finger protein 39, Zinc finger protein HTF6, Zinc finger protein KOX27) (APC) discontinued
044233-APC 200 µL

ZNF43, NT (ZNF43, KOX27, ZNF39, ZNF39L1, Zinc finger protein 43, Zinc finger protein 39, Zinc finger protein HTF6, Zinc finger protein KOX27) (APC) discontinued

Sign In for Pricing
View Details
Neurogenin1, NT (NEUROG1, BHLHA6, NEUROD3, NGN, NGN1, Neurogenin-1, Class A basic helix-loop-helix protein 6, Neurogenic basic-helix-loop-helix protein, Neurogenic differentiation factor 3) (Azide free) (HRP) discontinued
038915-HRP 200 µL

Neurogenin1, NT (NEUROG1, BHLHA6, NEUROD3, NGN, NGN1, Neurogenin-1, Class A basic helix-loop-helix protein 6, Neurogenic basic-helix-loop-helix protein, Neurogenic differentiation factor 3) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
MNF1 (UQCC2) Human Gene Knockout Kit (CRISPR)
KN403347 1 Kit

MNF1 (UQCC2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD80; B7-1 Protein (C-His, Rat)
P514192 100 µg

CD80; B7-1 Protein (C-His, Rat)

Sign In for Pricing
View Details