Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GREB1 Rabbit Polyclonal Antibody (Biotin)

GREB1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q4ZG55

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GREB1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MGNSYAGQLKTTRFEEVLHNSIEASLRSNNLVPRPIFSQLYLEAEQQLAA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_683701

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Rho-related GTP-binding protein RhoB, RHOB ELISA Kit
MBS9318354-01 48 Well

Rat Rho-related GTP-binding protein RhoB, RHOB ELISA Kit

Sign In for Pricing
View Details
Rat Rho-related GTP-binding protein RhoB, RHOB ELISA Kit
MBS9318354-02 96 Well

Rat Rho-related GTP-binding protein RhoB, RHOB ELISA Kit

Sign In for Pricing
View Details
Rat Rho-related GTP-binding protein RhoB, RHOB ELISA Kit
MBS9318354-03 5x 96 Well

Rat Rho-related GTP-binding protein RhoB, RHOB ELISA Kit

Sign In for Pricing
View Details
Rat Rho-related GTP-binding protein RhoB, RHOB ELISA Kit
MBS9318354-04 10x 96 Well

Rat Rho-related GTP-binding protein RhoB, RHOB ELISA Kit

Sign In for Pricing
View Details
FXYD6 Rabbit pAb
E45R20888N 50 ul

FXYD6 Rabbit pAb

Sign In for Pricing
View Details
Rabbit Polyclonal NRG4 Antibody [Alexa Fluor 594]
NBP2-99949AF594 0.1 mL

Rabbit Polyclonal NRG4 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details