Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM14 Rabbit Polyclonal Antibody (HRP)

TRIM14 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q5TBQ8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM14

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRV

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_150090

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 680 goat anti-mouse IgG (H+L) *Cross Adsorbed*
16566-AAT 200 µg

IFluor® 680 goat anti-mouse IgG (H+L) *Cross Adsorbed*

Sign In for Pricing
View Details
Recombinant Mouse CD73/NT5E Protein (His Tag)
PKSM040791-01 50 µg

Recombinant Mouse CD73/NT5E Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse CD73/NT5E Protein (His Tag)
PKSM040791-02 1 mg

Recombinant Mouse CD73/NT5E Protein (His Tag)

Sign In for Pricing
View Details
Progesterone Receptor (PGR) (C-term) Mouse Monoclonal Antibody [Clone ID: PR-6A]
AM21049PU-N 100 µg

Progesterone Receptor (PGR) (C-term) Mouse Monoclonal Antibody [Clone ID: PR-6A]

Sign In for Pricing
View Details
NDUFAF7 (NM_144736) Human Over-expression Lysate
LY403408 100 µg

NDUFAF7 (NM_144736) Human Over-expression Lysate

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF568 conjugate, 0.1mg/mL
BNC682338-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details