Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM14 Rabbit Polyclonal Antibody (Biotin)

TRIM14 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q5TBQ8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM14

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQLDIMNDLSNRV

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_150090

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPRD2 Polyclonal Antibody
orb615822-01 50 μL

RPRD2 Polyclonal Antibody

Sign In for Pricing
View Details
RPRD2 Polyclonal Antibody
orb615822-02 100 µL

RPRD2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ARA9/AIP Antibody Picoband® Fluoro550 Conjugated
PB9042-Fluoro550 100 µg/Vial

Anti-ARA9/AIP Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Beclin 1 (BECN1, GT197, Beclin-1, Coiled-coil myosin-like BCL2-interacting protein, Protein GT197) (Azide free) (HRP)
MBS6278113-01 0.2 mL

Beclin 1 (BECN1, GT197, Beclin-1, Coiled-coil myosin-like BCL2-interacting protein, Protein GT197) (Azide free) (HRP)

Sign In for Pricing
View Details
Beclin 1 (BECN1, GT197, Beclin-1, Coiled-coil myosin-like BCL2-interacting protein, Protein GT197) (Azide free) (HRP)
MBS6278113-02 5x 0.2 mL

Beclin 1 (BECN1, GT197, Beclin-1, Coiled-coil myosin-like BCL2-interacting protein, Protein GT197) (Azide free) (HRP)

Sign In for Pricing
View Details
PRX Protein Vector (Rat) (pPB-N-His)
PV296691 500 ng

PRX Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details