Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KMT5B Rabbit Polyclonal Antibody (HRP)

KMT5B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CGI85, MRD51, CGI-85, SUV420H1

UniProt

B7WNX7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SUV420H1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PVINSKYGLRETDKRLNRLKKLGDSSKNSDSQSVSSNTDADTTQEKNNAS

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057112

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SerpinB3 Recombinant Rabbit Monoclonal Antibody [JE55-93]
ET7111-21 100 µL

SerpinB3 Recombinant Rabbit Monoclonal Antibody [JE55-93]

Sign In for Pricing
View Details
Beta Arrestin 2 (ARRB2) Human Gene Knockout Kit (CRISPR)
KN201168BN 1 Kit

Beta Arrestin 2 (ARRB2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZCCHC14 Human Gene Knockout Kit (CRISPR)
KN210911 1 Kit

ZCCHC14 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant CHX10 Antibody
RC-16232-01 50 μL

Recombinant CHX10 Antibody

Sign In for Pricing
View Details
Recombinant CHX10 Antibody
RC-16232-02 100 µL

Recombinant CHX10 Antibody

Sign In for Pricing
View Details
Recombinant CHX10 Antibody
RC-16232-03 1 mL

Recombinant CHX10 Antibody

Sign In for Pricing
View Details