Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRLF1 Rabbit Polyclonal Antibody (FITC)

GRLF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GRF-1, GRLF1, P190A, P190-A, p190RhoGAP, p190ARhoGAP

UniProt

B2RTN5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GRLF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RPSADEFHLDHTSVLSTSDFGGRVVNNDHFLYWGEVSRSLEDCVECKMHI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

171kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_077318

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTYMK Antibody
E19-3128 100 µg -100 µL

DTYMK Antibody

Sign In for Pricing
View Details
Anti Human Versican Pab
111624 100 µg

Anti Human Versican Pab

Sign In for Pricing
View Details
Human Nei Endonuclease VIII Like Protein 3 (NEIL3) ELISA Kit
RDR-NEIL3-Hu-01 96 Tests

Human Nei Endonuclease VIII Like Protein 3 (NEIL3) ELISA Kit

Sign In for Pricing
View Details
Human Nei Endonuclease VIII Like Protein 3 (NEIL3) ELISA Kit
RDR-NEIL3-Hu-02 48 Tests

Human Nei Endonuclease VIII Like Protein 3 (NEIL3) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal Perilipin-3/TIP47 Antibody [DyLight 650]
NB110-40764C 0.1 mL

Rabbit Polyclonal Perilipin-3/TIP47 Antibody [DyLight 650]

Sign In for Pricing
View Details
Rabbit Polyclonal ANKH Antibody [PerCP]
NBP3-06185PCP 0.1 mL

Rabbit Polyclonal ANKH Antibody [PerCP]

Sign In for Pricing
View Details