Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arhgap5 Rabbit Polyclonal Antibody (FITC)

Arhgap5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P190, p190-, p190B, p190-B

UniProt

E9PYT0

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MMAKNKEPRPPSYTVSVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

172kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033836

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALG10B Antibody
E51A13775 100 µL

ALG10B Antibody

Sign In for Pricing
View Details
Lentiviral mouse Gdap1 shRNA (UAS) - Lentiviral mouse Gdap1 shRNA (UAS, iRFP) (100)
GTR15184671 1 Vial

Lentiviral mouse Gdap1 shRNA (UAS) - Lentiviral mouse Gdap1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
PIC W006-Tri 100-AL-CRD/1 AC Signs
827214 Card of 1 Pictogram(s)

PIC W006-Tri 100-AL-CRD/1 AC Signs

Sign In for Pricing
View Details
Cks1b sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4558903 1.0 µg DNA

Cks1b sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
PE anti-human CD2
E16FHP002-100 100 Tests

PE anti-human CD2

Sign In for Pricing
View Details
Human Peroxisome assembly factor 2 (PEX6) ELISA Kit
RK11750 96 Tests

Human Peroxisome assembly factor 2 (PEX6) ELISA Kit

Sign In for Pricing
View Details