Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arhgap5 Rabbit Polyclonal Antibody (HRP)

Arhgap5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P190, p190-, p190B, p190-B

UniProt

E9PYT0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MMAKNKEPRPPSYTVSVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

172kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033836

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD105 Antibody
KC-26085-01 50 μL

CD105 Antibody

Sign In for Pricing
View Details
CD105 Antibody
KC-26085-02 100 µL

CD105 Antibody

Sign In for Pricing
View Details
CD105 Antibody
KC-26085-03 1 mL

CD105 Antibody

Sign In for Pricing
View Details
Glycolysis Stress Fluorometric Assay Kit
E-BC-F084-01 48 Tests

Glycolysis Stress Fluorometric Assay Kit

Sign In for Pricing
View Details
Glycolysis Stress Fluorometric Assay Kit
E-BC-F084-02 96 Tests

Glycolysis Stress Fluorometric Assay Kit

Sign In for Pricing
View Details
Serpinb12 Mouse Gene Knockout Kit (CRISPR)
KN515577 1 Kit

Serpinb12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details