Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arhgap5 Rabbit Polyclonal Antibody (HRP)

Arhgap5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P190, p190-, p190B, p190-B

UniProt

E9PYT0

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MMAKNKEPRPPSYTVSVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

172kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033836

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C20 Ceramide-d39
TRC-C262399-10MG 10 mg

C20 Ceramide-d39

Sign In for Pricing
View Details
Carfentrazone Ethyl-d5
TRC-C183456-50MG 50 mg

Carfentrazone Ethyl-d5

Sign In for Pricing
View Details
Recombinant Mouse IL-23
PKSM041374-01 10 µg

Recombinant Mouse IL-23

Sign In for Pricing
View Details
Recombinant Mouse IL-23
PKSM041374-02 50 µg

Recombinant Mouse IL-23

Sign In for Pricing
View Details
PRPK (TP53RK) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G7]
TA808230BM 100 µL

PRPK (TP53RK) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G7]

Sign In for Pricing
View Details
Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/3219R), CF568 conjugate, 0.1mg/mL
BNC683219-100 1x 100 µL

Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/3219R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details