Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arhgap5 Rabbit Polyclonal Antibody (Biotin)

Arhgap5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P190, p190-, p190B, p190-B

UniProt

E9PYT0

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MMAKNKEPRPPSYTVSVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

172kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033836

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Trk system potassium uptake protein trkH (trkH)
MBS7032192-01 0.02 mg

Recombinant Trk system potassium uptake protein trkH (trkH)

Sign In for Pricing
View Details
Recombinant Trk system potassium uptake protein trkH (trkH)
MBS7032192-02 0.1 mg

Recombinant Trk system potassium uptake protein trkH (trkH)

Sign In for Pricing
View Details
Recombinant Trk system potassium uptake protein trkH (trkH)
MBS7032192-03 5x 0.1 mg

Recombinant Trk system potassium uptake protein trkH (trkH)

Sign In for Pricing
View Details
Phospho-PFKM/PFK1 (Ser775) Rabbit Polyclonal Antibody (BF750)
orb2499676 100 µL

Phospho-PFKM/PFK1 (Ser775) Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
MGC87042 Double Nickase Plasmid (h)
sc-418397-NIC 20 µg

MGC87042 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
HRASLS3 (PLA2G16, HRASLS3, HREV107, Group XVI Phospholipase A1/A2, Adipose-specific Phospholipase A2, H-rev 107 Protein Homolog, HRAS-like Suppressor 1, HRAS-like Suppressor 3, HREV107-1, HREV107-3, Renal Carcinoma Antigen NY-REN-65, MGC118754) (MaxLight
MBS6381657-01 0.1 mL

HRASLS3 (PLA2G16, HRASLS3, HREV107, Group XVI Phospholipase A1/A2, Adipose-specific Phospholipase A2, H-rev 107 Protein Homolog, HRAS-like Suppressor 1, HRAS-like Suppressor 3, HREV107-1, HREV107-3, Renal Carcinoma Antigen NY-REN-65, MGC118754) (MaxLight

Sign In for Pricing
View Details