Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM69 Rabbit Polyclonal Antibody (HRP)

TRIM69 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Trif, HSD34, RNF36, HSD-34

UniProt

Q86WT6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM69

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NKLHLQQHVSMEFLKLHQFLHSKEKDILTELREEGKALNEEMELNLSQLQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_542783

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 500 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121UR-01 25 µg

Elab Fluor® Violet 500 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse Ly6C Antibody[Monts 1]
E-AB-F1121UR-02 100 µg

Elab Fluor® Violet 500 Anti-Mouse Ly6C Antibody[Monts 1]

Sign In for Pricing
View Details
SIRT1 Mouse Monoclonal Antibody [Clone ID: OTI12H3]
CF809859 100 µg

SIRT1 Mouse Monoclonal Antibody [Clone ID: OTI12H3]

Sign In for Pricing
View Details
CUG BP1 (CELF1) (NM_006560) Human Recombinant Protein
TP306275 20 µg

CUG BP1 (CELF1) (NM_006560) Human Recombinant Protein

Sign In for Pricing
View Details
GATA4 Human Gene Knockout Kit (CRISPR)
KN210945LP 1 Kit

GATA4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HRP Conjugated V5 tag Rabbit Polyclonal Antibody
1008-4 100 µL

HRP Conjugated V5 tag Rabbit Polyclonal Antibody

Sign In for Pricing
View Details